PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G112200.1
Common NameB456_001G112200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 337aa    MW: 36298.1 Da    PI: 5.7347
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G112200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.61.6e-29165218155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         ++rl+Wtp+LH+rFv++v++L G++ A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Gorai.001G112200.1 165 RQRLVWTPQLHKRFVDVVAHL-GIKSAVPKTIMQLMNVEGLTRENVASHLQKYRL 218
                         58*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.484162221IPR017930Myb domain
SuperFamilySSF466892.69E-19162222IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-30164223IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-24166218IPR006447Myb domain, plants
PfamPF002496.2E-8168217IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGQEVKMRDF EANGGDDEEA TANAITTIVD DDDDDVEERV IEWEMGLPNC DDLTPLSQSL  60
IPPELASAFS ISPEPRRTTV DVNRASRNTL SSLRSTGAHS STTNNNNSNS NFRDTIVVEA  120
EGYGSGSGSG SDPKKMRKMD IAEEADSAVR TTENSDDPSG RTLKRQRLVW TPQLHKRFVD  180
VVAHLGIKSA VPKTIMQLMN VEGLTRENVA SHLQKYRLYL KRMQGLSNEG PSASDQLFAS  240
TPVPQSLHET GSGGGGGGGG SGGAGANGNG HLGMAIPMPY GAPMMPVPMP MCGHVGMHQG  300
LYHQQRQHHH QNGYEANSYG MMQQRDWSGG NRYGSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-19164223463ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1249260TGSGGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4713331e-113KC471333.1 Bombax ceiba clone 1 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475018.10.0PREDICTED: transcription factor LUX-like
RefseqXP_012475025.10.0PREDICTED: transcription factor LUX-like
SwissprotQ9SNB41e-89PCL1_ARATH; Transcription factor LUX
TrEMBLA0A0D2N8710.0A0A0D2N871_G
STRINGVIT_06s0004g05120.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.25e-82G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]